Streptomyces albidoflavus: XNR_3456 Help Entry XNR_3456          CDS       T02545                                  Name (GenBank) MbtH domain-containing protein   KO K05375   MbtH protein Organism salb  Streptomyces albidoflavus Pathway salb00261   Monobactam biosynthesis salb01100   Metabolic pathways salb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     XNR_3456  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salb01008]     XNR_3456 Polyketide biosynthesis proteins [BR:salb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     XNR_3456 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGI89798 UniProt:  A0A2A2UL61 LinkDB All DBs Position complement(3968509..3968766) Genome browser AA seq 85 aa AA seqDB search MENPFDDDNGIFYVLVNDENQHSLWPTFAKVPDGWTVVFGEDSRQNCLDYVEKNWTDMRP ASLIREMDGVPATSRGTAAQTAVPA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggagaacccgttcgacgacgacaacggcatcttctacgtgctggtcaacgacgagaac cagcactcgctgtggcccacgttcgccaaggtgccggacggctggacggtcgtcttcggc gaggacagccgccagaactgcctcgactacgtcgagaagaactggaccgacatgcggccc gccagcctgatacgcgagatggacggagtcccggccacctcccggggtacggcggcccag accgccgtacccgcctga

DBGET integrated database retrieval system