Streptomyces alboflavus: SMD44_08618 Help Entry SMD44_08618       CDS       T05221                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism salf  Streptomyces alboflavus Pathway salf00261   Monobactam biosynthesis salf01100   Metabolic pathways salf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMD44_08618  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salf01008]     SMD44_08618 Polyketide biosynthesis proteins [BR:salf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMD44_08618 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARX89131 UniProt:  A0A1Z1WRP7 LinkDB All DBs Position 9323541..9323747 Genome browser AA seq 68 aa AA seqDB search MTGDAPANPFDADGPTSAFVVLVNERHQHSLWPLFASVPDGWTVVYGPCPRATALEWVTA RDAGVLAR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccggcgacgcccccgccaaccccttcgacgcggacggccccacgagcgccttcgtc gtcctcgtcaacgaacggcaccagcactccctgtggccgctgttcgcgagcgtccccgac ggctggacggtcgtgtacggcccctgcccgcgcgccaccgcgctggagtgggtcaccgcg cgtgacgccggggtgctcgcccggtga

DBGET integrated database retrieval system