Streptomyces albireticuli: SMD11_0928 Help Entry SMD11_0928        CDS       T05230                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism salj  Streptomyces albireticuli Pathway salj00261   Monobactam biosynthesis salj01100   Metabolic pathways salj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMD11_0928  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salj01008]     SMD11_0928 Polyketide biosynthesis proteins [BR:salj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMD11_0928 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARZ66594 UniProt:  A0A1Z2KX20 LinkDB All DBs Position complement(1057514..1057717) Genome browser AA seq 67 aa AA seqDB search MSDAPANPFDGDGPFHVLVNAEGRHSLWPGFAAVPDGWTAVHGPCERQAALDWITENWTD LAPAAQG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgcacccgccaaccccttcgacggggacggccccttccacgtcctcgtcaac gccgagggccggcacagcctctggcccgggttcgccgccgttcccgacggctggaccgcc gtccacggcccgtgcgagcgccaggcggccctcgactggatcaccgagaactggaccgac ctggccccggcggcccaggggtga

DBGET integrated database retrieval system