Streptomyces albireticuli: SMD11_6084 Help Entry SMD11_6084        CDS       T05230                                  Symbol mbtH Name (GenBank) putative MbtH like protein   KO K05375   MbtH protein Organism salj  Streptomyces albireticuli Pathway salj00261   Monobactam biosynthesis salj01100   Metabolic pathways salj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMD11_6084 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salj01008]     SMD11_6084 (mbtH) Polyketide biosynthesis proteins [BR:salj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMD11_6084 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARZ71660 UniProt:  A0A1Z2LBH5 LinkDB All DBs Position 6954051..6954263 Genome browser AA seq 70 aa AA seqDB search MNPFDDADATFLVLTNAEGQHSLWPAFAEVPAGWTVAFGEDGHAACVAHIEANWTDMRPK SLTEPTDAQC NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgaacccgttcgacgacgccgacgcgacgttcctcgtcctgaccaacgcggagggccag cactcgctctggcccgccttcgccgaggtcccggccggctggacggtcgcgttcggcgag gacggccacgcggcctgcgtggcccacatcgaggcgaactggaccgacatgcggcccaag agcctgaccgagccgacggacgcgcagtgctga

DBGET integrated database retrieval system