Streptomyces noursei ZPM: SAZ_06380 Help Entry SAZ_06380         CDS       T03896                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism sall  Streptomyces noursei ZPM Pathway sall00261   Monobactam biosynthesis sall01100   Metabolic pathways sall01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sall00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SAZ_06380  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sall01008]     SAZ_06380 Polyketide biosynthesis proteins [BR:sall01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SAZ_06380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKA02096 LinkDB All DBs Position complement(1431965..1432165) Genome browser AA seq 66 aa AA seqDB search MTNPFEDADGTYLVLTNDQQQHSLWPARLAPPMGWTVAHGATGHQACLDYIDTHWADLTP KPALSN NT seq 201 nt NT seq  +upstreamnt  +downstreamnt gtgacgaaccccttcgaagacgccgacgggacctacctggtcctcaccaacgaccagcag cagcactccctgtggccggcccggctggcaccccccatgggctggaccgtggcccacggc gcgaccggccaccaggcgtgcctggactacatcgacacgcactgggccgacctgacgccg aagccggcgctcagcaactga

DBGET integrated database retrieval system