Salvelinus sp. IW2-2015 (Arctic char): 112074022 Help Entry 112074022         CDS       T05762                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp00860   Porphyrin metabolism salp04216   Ferroptosis salp04217   Necroptosis Brite KEGG Orthology (KO) [BR:salp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     112074022  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     112074022    04217 Necroptosis     112074022  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:salp04147]     112074022 Enzymes [BR:salp01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      112074022 Exosome [BR:salp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    112074022   Exosomal proteins of bladder cancer cells    112074022 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  112074022 NCBI-ProteinID:  XP_023997015 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search KPDRDEWGNGLEAMQCALQLEKNVNQALRDLHKIAFVKVDPHLCYFLESHYLNEQVEAIK KLGDHITNLTKMDAVNNKMACLTDLRGKVSCEMITEVVAFE NT seq 306 nt NT seq  +upstreamnt  +downstreamnt aagccagatcgtgatgagtggggcaatggactggaggccatgcagtgtgcactgcagctg gagaaaaatgtgaaccaggccctgcgggacctgcacaagattgcctttgtcaaggtcgac ccccatctgtgttacttcctggagtcccattacctgaatgagcaggtggaggccattaag aagctgggtgaccacatcaccaacctcaccaagatggatgctgtcaacaacaagatggcc tgtttgacagatttgcgagggaaggtatcttgtgaaatgatcacagaagttgttgctttt gagtaa

DBGET integrated database retrieval system