Candidatus Syntrophocurvum alkaliphilum: SYNTR_1282 Help Entry SYNTR_1282        CDS       T06326                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism salq  Candidatus Syntrophocurvum alkaliphilum Pathway salq00020   Citrate cycle (TCA cycle) salq01100   Metabolic pathways salq01110   Biosynthesis of secondary metabolites salq01120   Microbial metabolism in diverse environments salq01200   Carbon metabolism salq01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:salq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     SYNTR_1282 Enzymes [BR:salq01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SYNTR_1282 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_6 Fer4_9 Fer4_10 Fer4_8 Fer4_17 Fer4_4 Fer4_16 Fer4_15 Fer4_13 Fer4_3 Phage_int_SAM_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  QGT99875 UniProt:  A0A6I6DB16 LinkDB All DBs Position complement(1302610..1302825) Genome browser AA seq 71 aa AA seqDB search MPKGRVRFVAELCKACQLCVRFCPKDVLSLDKHIINVLGYHPVKAINPDDCNGCATCALM CPDLVITVERE NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgccgaagggaagagttcgttttgttgctgaactctgtaaagcatgtcagctttgtgtt cgtttttgtcctaaagatgtcttatcattggacaagcatatcatcaacgttttaggctac catccggtaaaagcaattaatccagatgattgtaatgggtgtgcaacttgcgcactgatg tgtccggatcttgttattacggtagaaagggagtga

DBGET integrated database retrieval system