Streptomyces albus: SLNWT_1134 Help Entry SLNWT_1134        CDS       T03823                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism sals  Streptomyces albus Pathway sals00261   Monobactam biosynthesis sals01100   Metabolic pathways sals01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sals00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLNWT_1134  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sals01008]     SLNWT_1134 Polyketide biosynthesis proteins [BR:sals01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLNWT_1134 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH PhageMetallopep Motif Other DBs NCBI-ProteinID:  AJE81510 UniProt:  A0A0B5EQD5 LinkDB All DBs Position complement(1562066..1562299) Genome browser AA seq 77 aa AA seqDB search MTNPFEDPDGTYHVLVNSEGQHSLWPTFAEVPAGWETALREESRDACLEFIEENWTDMRP RSLVAFMENTEAAEAGA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgaggacccggacggcacctaccacgtcctcgtgaactccgagggc cagcactccctgtggccgacgttcgccgaggttccggcgggctgggagaccgccctccgc gaggagagccgggacgcgtgcctggagttcatcgaggagaactggaccgacatgcgtccc cggagcctcgtcgcgttcatggagaacacggaggctgccgaggccggggcgtag

DBGET integrated database retrieval system