Streptomyces albus: SLNWT_7005 Help Entry SLNWT_7005        CDS       T03823                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism sals  Streptomyces albus Pathway sals00261   Monobactam biosynthesis sals01100   Metabolic pathways sals01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sals00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLNWT_7005  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sals01008]     SLNWT_7005 Polyketide biosynthesis proteins [BR:sals01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLNWT_7005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJE87381 UniProt:  A0A0B5F972 LinkDB All DBs Position 8031061..8031273 Genome browser AA seq 70 aa AA seqDB search MTTNPFEQEIPYAVLVNDENQHSLWPAHLDVPGGWRQMFGPAEREECMAYVEREWTDMRP RSLAEEMDSR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgacgacgaaccccttcgagcaggagatcccgtacgccgtgctcgtcaacgacgagaac cagcactcgctctggcccgcgcatctggacgtcccgggcggctggcgccagatgttcgga cccgcggagcgggaggagtgcatggcctatgtcgaacgggagtggaccgatatgcggccg cgaagccttgcggaggagatggacagccgctga

DBGET integrated database retrieval system