Streptomyces noursei NK660: DC74_1238 Help Entry DC74_1238         CDS       T03082                                  Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism salu  Streptomyces noursei NK660 Pathway salu00261   Monobactam biosynthesis salu01100   Metabolic pathways salu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DC74_1238  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salu01008]     DC74_1238 Polyketide biosynthesis proteins [BR:salu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DC74_1238 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIA01756 LinkDB All DBs Position 1354235..1354432 Genome browser AA seq 65 aa AA seqDB search MSGNPFDDGEGDWLVVSDADGRHALWRPQLPVPKGWRIVYSGPHRDGALDFVEQNVGATA GTPTA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgagcggcaaccccttcgacgacggcgagggtgactggctggtcgtctcggacgccgac ggacggcacgccctgtggcgcccgcagctaccggtgccgaagggctggcggatcgtctac tccggcccgcaccgcgacggcgccctcgacttcgtcgagcagaacgtcggggcgacggcg ggcacgccgacggcctga

DBGET integrated database retrieval system