Streptomyces noursei NK660: DC74_5992 Help Entry DC74_5992         CDS       T03082                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism salu  Streptomyces noursei NK660 Pathway salu00261   Monobactam biosynthesis salu01100   Metabolic pathways salu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DC74_5992  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salu01008]     DC74_5992 Polyketide biosynthesis proteins [BR:salu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DC74_5992 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  AIA06437 LinkDB All DBs Position complement(6867473..6867685) Genome browser AA seq 70 aa AA seqDB search MTNPFDNEDGTFLVLVNDERQHSLWPAFAVVPAGWEVVVTETDRQSCLDYIEKNWTDMRP ASLADAVSAS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacaacgaggacggcacgttcctggtgctggtcaacgacgagcgc cagcacagtctgtggcccgcgttcgccgtcgtaccggcgggctgggaggtggtcgtgacg gaaaccgaccggcagagctgcctcgactacatcgagaagaactggacggacatgcgcccg gccagtctcgccgacgcggtctccgcgagctga

DBGET integrated database retrieval system