Streptomyces noursei NK660: DC74_962 Help Entry DC74_962          CDS       T03082                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism salu  Streptomyces noursei NK660 Pathway salu00261   Monobactam biosynthesis salu01100   Metabolic pathways salu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DC74_962  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salu01008]     DC74_962 Polyketide biosynthesis proteins [BR:salu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DC74_962 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIA01482 LinkDB All DBs Position complement(1008774..1008983) Genome browser AA seq 69 aa AA seqDB search MSEDKGTQEWTVVVNDEEQYSIWAVNRQIPGGWKETGVRGTQEECLSHIDQVWSDMRPLS LRLAMDAAG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcgaggacaagggcacccaggaatggaccgtcgtggtcaacgacgaggagcagtac tcgatctgggcggtgaaccggcagatccccggcggctggaaggagaccggcgtacgcggc acccaggaggagtgcctgagccatatcgaccaggtctggagcgacatgcggccgctgagc ctccgtctggccatggacgccgccgggtga

DBGET integrated database retrieval system