Streptomyces alboniger: CP975_00265 Help Entry CP975_00265       CDS       T06908                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism salw  Streptomyces alboniger Pathway salw00261   Monobactam biosynthesis salw01100   Metabolic pathways salw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP975_00265  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salw01008]     CP975_00265 Polyketide biosynthesis proteins [BR:salw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP975_00265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV16163 UniProt:  A0A5J6HCG7 LinkDB All DBs Position complement(60150..60362) Genome browser AA seq 70 aa AA seqDB search MTTNPFDDENGTFYVLVNDEEQHSLWPSFAHIPDGWRIAFGPQDRPKCLAHIEENWTDLR PRSLRLAMGE NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgaccacgaaccccttcgacgacgagaacggcacgttctacgtcctggtgaacgacgag gaacagcactccctctggccgtccttcgcacacatcccggacggctggcggatcgccttc ggtccgcaggaccggccgaagtgccttgcccacatagaggagaactggaccgatctgcgg cccaggagcctgcgcctggccatgggcgagtag

DBGET integrated database retrieval system