Streptomyces alboniger: CP975_03180 Help Entry CP975_03180       CDS       T06908                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism salw  Streptomyces alboniger Pathway salw00261   Monobactam biosynthesis salw01100   Metabolic pathways salw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP975_03180  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salw01008]     CP975_03180 Polyketide biosynthesis proteins [BR:salw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP975_03180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV16638 UniProt:  A0A5J6HAK0 LinkDB All DBs Position 765207..765416 Genome browser AA seq 69 aa AA seqDB search MTNPFEDADGTYLVLVNDLRQHSLWPALSAVPAGWSAVHGPASRQACLDHVEAVWTDLRP KAPQDNGPA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgactaatcccttcgaggatgccgacggcacctacctcgtactcgtcaacgacctgcgc cagcactccctgtggcccgccctgagcgccgtacccgccggctggtcggccgtgcacgga cccgcgtcgcggcaggcctgcctggatcacgtcgaggccgtctggaccgacctgcgcccg aaggccccccaggacaacggcccggcctga

DBGET integrated database retrieval system