Streptomyces alboniger: CP975_14825 Help Entry CP975_14825       CDS       T06908                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism salw  Streptomyces alboniger Pathway salw00261   Monobactam biosynthesis salw01100   Metabolic pathways salw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP975_14825  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salw01008]     CP975_14825 Polyketide biosynthesis proteins [BR:salw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP975_14825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH CABIT Motif Other DBs NCBI-ProteinID:  QEV18595 UniProt:  A0A5J6HNJ5 LinkDB All DBs Position 3373433..3373606 Genome browser AA seq 57 aa AA seqDB search MSDAPANPFDADGEFLVLANDRGEHSLWPLFAAMPDGWTAVHGPCPRQDALAWVSGR NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atgagtgacgcacccgccaaccccttcgacgccgacggggagttcctggtcctggccaac gaccggggcgagcactcgctgtggccgctgttcgccgcgatgcccgacggctggacggcc gtgcacggcccgtgcccgcgtcaggacgccctggcctgggtctccggccggtga

DBGET integrated database retrieval system