Streptomyces alboniger: CP975_24335 Help Entry CP975_24335       CDS       T06908                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism salw  Streptomyces alboniger Pathway salw00261   Monobactam biosynthesis salw01100   Metabolic pathways salw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP975_24335  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salw01008]     CP975_24335 Polyketide biosynthesis proteins [BR:salw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP975_24335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV20243 UniProt:  A0A5J6HP37 LinkDB All DBs Position 5398825..5399031 Genome browser AA seq 68 aa AA seqDB search MASNPFEDDGADYLVLVNDENQHALWPAGLDIPSGWTVAQEASSRADSLAYVEEHWTDMR PAGLISGS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggccagtaatccatttgaagatgatggcgcggattatctggtactcgtgaacgacgag aaccagcacgctctctggcccgccgggctcgacatcccctccggctggaccgtcgcacaa gaggcgagttcacgggccgattccctggcctacgtcgaggagcattggacggatatgcgt ccggccggcctgatatccggctcctga

DBGET integrated database retrieval system