Streptomyces ambofaciens: SAM23877_7042 Help Entry SAM23877_7042     CDS       T04055                                  Symbol cchH Name (GenBank) Protein MbtH   KO K05375   MbtH protein Organism samb  Streptomyces ambofaciens Pathway samb00261   Monobactam biosynthesis samb01100   Metabolic pathways samb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:samb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SAM23877_7042 (cchH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:samb01008]     SAM23877_7042 (cchH) Polyketide biosynthesis proteins [BR:samb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SAM23877_7042 (cchH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKZ60087 UniProt:  A0ACQ3 LinkDB All DBs Position 7600218..7600430 Genome browser AA seq 70 aa AA seqDB search MSTNPFDDTEGRFLVLVNDEGQHSLWPSFAEVPGGWTVAFEENTRDACLEYVEANWTDLR PRSLAEAMDA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgatgacaccgagggccgtttcctcgtcctggtgaacgacgag ggccagcactcgctctggccctccttcgcggaggtgcccggagggtggacggtcgccttc gaggagaacacccgggacgcctgcctggagtacgtcgaggccaactggacggacctgcgc ccgcgttccctcgccgaggccatggacgcctga

DBGET integrated database retrieval system