Streptomyces anulatus: KZO11_19595 Help Entry KZO11_19595       CDS       T09280                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sanl  Streptomyces anulatus Pathway sanl00261   Monobactam biosynthesis sanl01100   Metabolic pathways sanl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sanl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KZO11_19595  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sanl01008]     KZO11_19595 Polyketide biosynthesis proteins [BR:sanl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KZO11_19595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QYA95695 LinkDB All DBs Position 4470588..4470809 Genome browser AA seq 73 aa AA seqDB search MSTNPFEDKDASYYVLVNEEGQHSLWPAFAEVPAGWTIAHGQADREACLEYVNKNWTDMR PLSLVREMEAAGK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatcctttcgaggacaaggacgccagctactacgtgctggtcaacgaggag ggtcagcactcgctgtggccggccttcgccgaggtcccggcgggctggaccatcgcgcac ggccaggccgaccgggaggcctgcctggagtacgtgaacaagaactggaccgacatgcgg ccgctcagcctggtgcgggagatggaagccgccggcaagtag

DBGET integrated database retrieval system