Streptomyces anulatus: KZO11_35495 Help Entry KZO11_35495       CDS       T09280                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sanl  Streptomyces anulatus Pathway sanl00261   Monobactam biosynthesis sanl01100   Metabolic pathways sanl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sanl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KZO11_35495  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sanl01008]     KZO11_35495 Polyketide biosynthesis proteins [BR:sanl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KZO11_35495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QYA98498 LinkDB All DBs Position complement(8149454..8149663) Genome browser AA seq 69 aa AA seqDB search MSAHDGPVRAPEAWLAVVNDEGQHSLWAAGAALPEGWRAAGFEGGHEECLAWIEREWTDI SPLSTRRDP NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgagcgcccacgacgggccggtccgggcgccggaggcgtggctggccgtcgtcaacgac gagggccagcactcgctctgggccgccggcgcagccctcccggagggctggcgtgcggcc gggttcgaaggcggccacgaggagtgtctggcctggatcgagcgggagtggaccgatatc tctccgttgagcacccgccgtgatccgtag

DBGET integrated database retrieval system