Streptomyces anulatus: KZO11_35590 Help Entry KZO11_35590       CDS       T09280                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sanl  Streptomyces anulatus Pathway sanl00261   Monobactam biosynthesis sanl01100   Metabolic pathways sanl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sanl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KZO11_35590  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sanl01008]     KZO11_35590 Polyketide biosynthesis proteins [BR:sanl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KZO11_35590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QYA98516 LinkDB All DBs Position complement(8181287..8181499) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDAEGRFLVLVNDEGQHSLWPSFAEVPGGWTIAFEENTREACLNYVETNWTDLR PLSLVASMEA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcacgaatccgttcgacgacgccgagggccgtttcctggttctggtgaacgacgag gggcagcactccctctggccgtccttcgccgaggtgcccggagggtggacgatcgccttc gaggagaacacccgggaggcgtgcctgaactacgtcgagaccaactggaccgacctgcgc cccctgtccctcgtggcgtccatggaagcctga

DBGET integrated database retrieval system