Streptomyces antimycoticus: QR300_27960 Help Entry QR300_27960       CDS       T09335                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sant  Streptomyces antimycoticus Pathway sant00261   Monobactam biosynthesis sant01100   Metabolic pathways sant01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sant00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QR300_27960  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sant01008]     QR300_27960 Polyketide biosynthesis proteins [BR:sant01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QR300_27960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WJD99519 LinkDB All DBs Position 6529064..6529282 Genome browser AA seq 72 aa AA seqDB search MSNPFENPDGRYFVLVNEEGQHSLWPVFAEVPAGWTVAHGEDDRQACLDYVNEHWTDMRP KSLITAMDGTSA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgagaaccccgacggccgctatttcgtgctcgtcaacgaggagggg cagcactccctgtggccggtcttcgccgaggtccccgcgggctggacggtcgcccatggc gaggacgaccgccaggcgtgcctggactacgtcaacgagcactggaccgatatgcggccc aagagcctgatcaccgcgatggacggcacctcggcctga

DBGET integrated database retrieval system