Streptomyces aureoverticillatus: G3H79_40130 Help Entry G3H79_40130       CDS       T08343                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism saov  Streptomyces aureoverticillatus Pathway saov00261   Monobactam biosynthesis saov01100   Metabolic pathways saov01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saov00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     G3H79_40130  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:saov01008]     G3H79_40130 Polyketide biosynthesis proteins [BR:saov01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     G3H79_40130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QIB48371 LinkDB All DBs Position 9521028..9521240 Genome browser AA seq 70 aa AA seqDB search MSTNPFDDESGVFLVLINDEEQYSLWPSFVDVPVGWRSVLGPEARQNCMDYIERNWTDMR PKSLVEAMGE NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgagcacgaacccgttcgacgacgagtccggcgtcttcctcgtcctcatcaacgacgag gaacagtattcgctgtggccgtcgttcgtggacgtacctgtcggctggcgcagcgtcctc ggcccggaggcgcgtcagaactgcatggactacatcgagcggaactggaccgacatgcgg cccaagagccttgttgaggccatgggcgagtag

DBGET integrated database retrieval system