Sulfobacillus acidophilus DSM 10332: Sulac_0207 Help Entry Sulac_0207        CDS       T01746                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sap  Sulfobacillus acidophilus DSM 10332 Pathway sap00790   Folate biosynthesis sap01100   Metabolic pathways sap01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:sap00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Sulac_0207 Enzymes [BR:sap01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Sulac_0207  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Sulac_0207  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Sulac_0207 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF4518 Motif Other DBs NCBI-ProteinID:  AEW03779 UniProt:  G8TWT1 LinkDB All DBs Position 232482..232838 Genome browser AA seq 118 aa AA seqDB search MGWIYLRRLRFFAVHGLLPEERRHPQEFWVDVRCQVDFKRASETDDVADTVNYADIVAAV RSVVEGEPVNLLERLARQVAEAVRAVDRRIGAIEVTITKVRPPFPVDSAGVEVTWYAD NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggggtggatttatttacgtcggttacggttttttgccgttcatggacttttgccggag gagcgtcgacacccgcaggaattttgggtggacgtccgctgtcaggtcgacttcaagcgg gcgtcggaaactgacgatgtggcggatacggtgaactatgccgatatcgtggcggcggtg cggtcggtcgtggagggtgagcccgtcaatttgttggaacggttggcccggcaggtggct gaggcggttcgtgccgtagaccggcggatcggggcgattgaagtgacgatcaccaaggtt cgcccgccctttccggtggatagcgccggcgtggaggtgacgtggtacgccgattaa

DBGET integrated database retrieval system