Salinispora arenicola: Sare_4896 Help Entry Sare_4896         CDS       T00613                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism saq  Salinispora arenicola Pathway saq00261   Monobactam biosynthesis saq01100   Metabolic pathways saq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Sare_4896  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:saq01008]     Sare_4896 Polyketide biosynthesis proteins [BR:saq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Sare_4896 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABW00646 UniProt:  A8LVF7 LinkDB All DBs Position complement(5562582..5562791) Genome browser AA seq 69 aa AA seqDB search MEESEDPRPYHVVVNDEEQYSIWPDGSEVPAGWRMVGFSGDRASCLAHIDEVWTDLRPRG LREWLAAQG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagaatccgaggatccgcgcccctaccacgtcgtggtgaacgacgaggagcagtat tcgatctggccggacgggtcggaggttccggccggatggcgcatggtgggcttcagcggc gatcgggccagctgcctcgcgcacatcgacgaggtctggaccgacctgcgcccgcgaggg ctgcgggagtggctggccgcccagggctga

DBGET integrated database retrieval system