Streptomyces aquilus: EJC51_07350 Help Entry EJC51_07350       CDS       T07011                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism saqu  Streptomyces aquilus Pathway saqu00261   Monobactam biosynthesis saqu01100   Metabolic pathways saqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saqu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EJC51_07350  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:saqu01008]     EJC51_07350 Polyketide biosynthesis proteins [BR:saqu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EJC51_07350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZP15938 UniProt:  A0A3Q9BTI7 LinkDB All DBs Position complement(1580333..1580551) Genome browser AA seq 72 aa AA seqDB search MSTNPFDDTEGRFLVLVNDEGQHSLWPSFAEVPGGWTVVFEENTRDACLAYVETNWTDLR PRSLFSPAPGPS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccgttcgacgacaccgaaggccgtttcctggtcctggtgaacgacgag ggccagcactcgctctggccctcgttcgccgaggtccccggcggctggacggtcgtcttc gaggagaacacccgggacgcctgcctggcctatgtcgagaccaactggacggacctgcgc cccaggtccctgttcagcccagcgcccggtccaagttga

DBGET integrated database retrieval system