Streptomyces aquilus: EJC51_23040 Help Entry EJC51_23040       CDS       T07011                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism saqu  Streptomyces aquilus Pathway saqu00261   Monobactam biosynthesis saqu01100   Metabolic pathways saqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saqu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EJC51_23040  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:saqu01008]     EJC51_23040 Polyketide biosynthesis proteins [BR:saqu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EJC51_23040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZP18701 UniProt:  A0A3Q9C228 LinkDB All DBs Position complement(5014305..5014529) Genome browser AA seq 74 aa AA seqDB search MANPFDDEDGTFLVLVNRENQHSLWPAFAEIPNGWRLVFGEASRKECLAYVEESWTDLRP QSLIDAMKETEAAR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcgaacccgttcgatgatgaagacgggacctttctggtgctcgtgaacagggaaaat cagcactcgttgtggcctgcattcgctgaaattccgaatggctggcggctcgttttcgga gaggcctcgcgcaaggaatgcctcgcctatgtggaggagagctggacggatctccgtccg cagagcctcatcgacgccatgaaggagaccgaggcggcccgctag

DBGET integrated database retrieval system