Streptomyces aquilus: EJC51_45205 Help Entry EJC51_45205       CDS       T07011                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism saqu  Streptomyces aquilus Pathway saqu00261   Monobactam biosynthesis saqu01100   Metabolic pathways saqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saqu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EJC51_45205  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:saqu01008]     EJC51_45205 Polyketide biosynthesis proteins [BR:saqu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EJC51_45205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZP22631 UniProt:  A0A3S9IE14 LinkDB All DBs Position complement(9904134..9904385) Genome browser AA seq 83 aa AA seqDB search MTQPDFANGADAEEARPGTDEEYLVVRNDEEQYSIWRADRALPAGWHPEGLRGGRQACLD HIGEIWTDMRPLSLRRRLAEADA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgacgcaacccgacttcgccaacggcgcggacgccgaggaggcccgcccgggcaccgac gaggagtacctcgtggtgcgcaacgacgaggagcagtactcgatctggcgggcggaccgc gcactccccgcgggctggcacccggagggactgcgcggcggccggcaggcgtgcttggac cacatcggcgagatctggacggacatgcgtccgctgagcctgcgccgacggctggccgag gcagatgcctga

DBGET integrated database retrieval system