Salmo salar (Atlantic salmon): 106561428 Help Entry 106561428         CDS       T04363                                  Name (RefSeq) GTPase KRas   KO K07827   GTPase KRas Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04012   ErbB signaling pathway sasa04068   FoxO signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04150   mTOR signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence sasa04370   VEGF signaling pathway sasa04371   Apelin signaling pathway sasa04540   Gap junction sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa04910   Insulin signaling pathway sasa04912   GnRH signaling pathway sasa04914   Progesterone-mediated oocyte maturation sasa04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106561428    04012 ErbB signaling pathway     106561428    04370 VEGF signaling pathway     106561428    04371 Apelin signaling pathway     106561428    04068 FoxO signaling pathway     106561428    04150 mTOR signaling pathway     106561428  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106561428    04137 Mitophagy - animal     106561428   09143 Cell growth and death    04210 Apoptosis     106561428    04218 Cellular senescence     106561428   09144 Cellular community - eukaryotes    04540 Gap junction     106561428   09142 Cell motility    04810 Regulation of actin cytoskeleton     106561428  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106561428   09152 Endocrine system    04910 Insulin signaling pathway     106561428    04912 GnRH signaling pathway     106561428    04914 Progesterone-mediated oocyte maturation     106561428    04916 Melanogenesis     106561428  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106561428   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sasa04031]     106561428 Membrane trafficking [BR:sasa04131]  Endocytosis   Macropinocytosis    Ras GTPases     106561428 GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106561428 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  106561428 NCBI-ProteinID:  XP_013980870 UniProt:  C0HAH5 LinkDB All DBs Position ssa10:complement(94197495..94209169) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYSLVREIRLYRLKKLSKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagctggtggtggtgggagcaggaggcgtgggcaagagcgcgctcacc atccagctcattcagaaccactttgtggatgaatatgaccccaccatcgaggactcgtac aggaagcaggtggtgattgatggggagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtccttcgaggacatccaccactatagagagcagatc aagcgggtgaaagactcagaagacgtgcccatggtgttggtggggaacaagtgtgacctg ccgtcccggacggtagacaccaaacaggctcaggacttagcgcgcagctacggcatcccc ttcattgagacctcagccaaaacgagacagagagtggaggatgccttttacagtctggta cgggagatcaggctgtaccggctgaaaaagctcagcaaggaagaaaagaccccgcgctgc gtcaagcttaaaaagtgtgttgtgatgtga

DBGET integrated database retrieval system