Streptomyces calvus: CD934_09925 Help Entry CD934_09925       CDS       T06819                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism sast  Streptomyces calvus Pathway sast00261   Monobactam biosynthesis sast01100   Metabolic pathways sast01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sast00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CD934_09925  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sast01008]     CD934_09925 Polyketide biosynthesis proteins [BR:sast01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CD934_09925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QDI68976 UniProt:  A0A514JNR9 LinkDB All DBs Position 2448093..2448344 Genome browser AA seq 83 aa AA seqDB search MTQPDSTTGAGADETRTDTGEVYLVVRNDEEQYSIWRADREVPAGWYPEGTRGSRQECLD RIDVVWTDMRPLSLRRRLAGADV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacgcaacccgactccacgaccggcgcgggcgccgacgagacccgcacggacaccggc gaggtgtacctcgtggtgcgcaacgacgaggagcagtactcgatctggcgggcggaccgc gaggtgcccgccggctggtacccggagggcacgcggggcagccggcaggagtgcctcgac cgcatcgacgtggtctggacggacatgcgcccgctcagcctgcgccgccggctggccggg gcagatgtctga

DBGET integrated database retrieval system