Streptomyces calvus: CD934_23880 Help Entry CD934_23880       CDS       T06819                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sast  Streptomyces calvus Pathway sast00261   Monobactam biosynthesis sast01100   Metabolic pathways sast01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sast00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CD934_23880  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sast01008]     CD934_23880 Polyketide biosynthesis proteins [BR:sast01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CD934_23880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QDI71376 UniProt:  A0A0N9M601 LinkDB All DBs Position 5558466..5558684 Genome browser AA seq 72 aa AA seqDB search MSTNPFEDNDAQYRVLVNDEGQHSLWPAFAEVPAGWTVAHPEDSRQACLDYVNENWTDMR PLSLVRQMEGAK NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatcctttcgaggacaacgacgcccagtaccgcgtgctggtcaacgacgag gggcagcactcgctgtggccggcgttcgccgaggtcccggcgggctggacggtggcgcac cccgaggacagccgccaggcctgcctcgactacgtcaacgagaactggaccgacatgcgt ccgctcagcctggtgcgccagatggaaggcgccaagtag

DBGET integrated database retrieval system