Streptomyces calvus: CD934_30590 Help Entry CD934_30590       CDS       T06819                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sast  Streptomyces calvus Pathway sast00261   Monobactam biosynthesis sast01100   Metabolic pathways sast01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sast00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CD934_30590  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sast01008]     CD934_30590 Polyketide biosynthesis proteins [BR:sast01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CD934_30590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH CNPase Motif Other DBs NCBI-ProteinID:  QDI72562 UniProt:  A0A514K0H3 LinkDB All DBs Position complement(7076069..7076281) Genome browser AA seq 70 aa AA seqDB search MSENQQTPEFHVVVNDEEQYSIWPADRDLPAGWRSGGPSGSREACLEHIERVWTDMRPLS VRRHADAAAG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgtccgagaaccagcagaccccggaattccacgtggtggtcaacgacgaggagcagtac tcgatctggcccgccgaccgcgacctgccggcgggctggcgctccggcggcccgtccggc agccgtgaggcgtgcctggagcacatcgagcgggtgtggacggacatgcggccgctgagc gtgcgccggcacgccgacgcggcggccggctga

DBGET integrated database retrieval system