Syntrophus aciditrophicus: SYN_02497 Help Entry SYN_02497         CDS       T00346                                  Name (GenBank) ferridoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sat  Syntrophus aciditrophicus Pathway sat00020   Citrate cycle (TCA cycle) sat01100   Metabolic pathways sat01110   Biosynthesis of secondary metabolites sat01120   Microbial metabolism in diverse environments sat01200   Carbon metabolism sat01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:sat00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     SYN_02497 Enzymes [BR:sat01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SYN_02497 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_9 Fer4_2 Fer4_10 Fer4_6 Fer4_4 Fer4_8 Fer4_16 Fer4_22 Fer4_17 Fer4_3 Fer4_15 Fer4_13 DUF4921 ETF_QO Motif Other DBs NCBI-ProteinID:  ABC78290 UniProt:  Q2LW28 LinkDB All DBs Position 2443394..2443711 Genome browser AA seq 105 aa AA seqDB search MQSTGKKKTGGNSVSGVILHKRQTDRTENRSKKKGPSHIDVFREWCKGCGICVAFCPKQV LALDENGHSYAKNPEACIQCGMCEMRCPDFAISVVGKKTGASVEG NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcaaagcaccgggaagaagaaaactggcggtaattcggtttcaggtgttatacttcat aaaagacagacggacagaacagagaacaggagtaagaagaaagggccgtcgcacattgac gtcttcagggagtggtgcaagggttgcggcatctgcgtcgccttttgcccgaagcaggtg cttgccctcgatgaaaacggccattcatacgcgaagaatcctgaggcctgtattcagtgc ggcatgtgcgagatgagatgccctgactttgccatctccgtggtgggaaaaaagaccggg gcttcggtggagggatag

DBGET integrated database retrieval system