Streptomyces atratus: C5746_26070 Help Entry C5746_26070       CDS       T07374                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sata  Streptomyces atratus Pathway sata00261   Monobactam biosynthesis sata01100   Metabolic pathways sata01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sata00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C5746_26070  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sata01008]     C5746_26070 Polyketide biosynthesis proteins [BR:sata01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C5746_26070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXE79821 UniProt:  A0A2Z5JHJ9 LinkDB All DBs Position 5641599..5641811 Genome browser AA seq 70 aa AA seqDB search MATNPFEDDNASYYVLVNEENEHSLWPAFAEVPAGWTVVFGEGARQACLDHIAENWTDMR PKSLAMAMDA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcgaccaacccgttcgaagacgacaacgcgagctactacgtcctggtcaacgaggag aacgagcactcgctgtggcccgcgttcgccgaggtgcctgccggctggaccgtggtgttc ggcgagggggcccggcaggcatgcctcgaccacatcgccgagaactggaccgacatgcgg cccaagagccttgcgatggccatggacgcctga

DBGET integrated database retrieval system