Streptomyces atratus: C5746_38535 Help Entry C5746_38535       CDS       T07374                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sata  Streptomyces atratus Pathway sata00261   Monobactam biosynthesis sata01100   Metabolic pathways sata01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sata00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C5746_38535  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sata01008]     C5746_38535 Polyketide biosynthesis proteins [BR:sata01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C5746_38535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXE81857 UniProt:  A0A2Z5JN48 LinkDB All DBs Position 8575038..8575250 Genome browser AA seq 70 aa AA seqDB search MTNPFENPDGRYVVLVNHEDQHSLWPVFAEVPAGWTVAHPEDSRQACLDYIEEHWTDMRP KSLVEQMGGR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgagaatcctgacggccggtatgttgtgctggtcaatcacgaggac cagcactcgctctggccggtcttcgcggaggtgccggccggctggacggtcgctcacccg gaggacagccgccaggcctgcctcgactacatcgaggagcactggaccgacatgcggccc aaaagcctcgtcgagcagatgggcggccgatga

DBGET integrated database retrieval system