Streptomyces autolyticus: BV401_17010 Help Entry BV401_17010       CDS       T04980                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sauo  Streptomyces autolyticus Pathway sauo00261   Monobactam biosynthesis sauo01100   Metabolic pathways sauo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sauo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BV401_17010  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sauo01008]     BV401_17010 Polyketide biosynthesis proteins [BR:sauo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BV401_17010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQA11915 UniProt:  A0A1P8XV03 LinkDB All DBs Position complement(4246271..4246489) Genome browser AA seq 72 aa AA seqDB search MSNPFENPDGRYLVLVNEEGQHSLWPAFAEVPAGWTVAHGEDDRQACLDHINEHWTDMRP KSLITAMDGTPA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgagaaccccgacggccgttatctcgtgctcgtcaacgaggagggg cagcactcgctgtggccggccttcgccgaggtccccgcgggctggacggtcgcccacggc gaggacgaccgccaggcgtgcctggaccacatcaacgagcactggaccgatatgcggccc aagagcctgatcaccgcgatggacggcaccccggcctga

DBGET integrated database retrieval system