Streptomyces autolyticus: BV401_32995 Help Entry BV401_32995       CDS       T04980                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sauo  Streptomyces autolyticus Pathway sauo00261   Monobactam biosynthesis sauo01100   Metabolic pathways sauo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sauo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BV401_32995  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sauo01008]     BV401_32995 Polyketide biosynthesis proteins [BR:sauo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BV401_32995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQA14519 UniProt:  A0A1P8Y261 LinkDB All DBs Position 7988082..7988294 Genome browser AA seq 70 aa AA seqDB search MSNPFENAEGRFFVLVNDERQYSLWPAFAEVPAGWTVVHGEDTREACLEHIDQNWTDMRP KSLVDAMNAV NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgagaacgccgagggccgcttcttcgtcctggtcaacgacgagcgg cagtactccctctggccggccttcgccgaggtcccggccggctggacggtcgtccacggc gaggacacccgcgaggcgtgcctggagcacatcgaccagaactggaccgacatgcggccc aagagcctggtcgacgcgatgaacgccgtctga

DBGET integrated database retrieval system