Streptomyces bathyalis: G4Z16_06030 Help Entry G4Z16_06030       CDS       T07305                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sbat  Streptomyces bathyalis Pathway sbat00261   Monobactam biosynthesis sbat01100   Metabolic pathways sbat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbat00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     G4Z16_06030  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sbat01008]     G4Z16_06030 Polyketide biosynthesis proteins [BR:sbat01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     G4Z16_06030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QPP06031 UniProt:  A0A7T1T468 LinkDB All DBs Position complement(1394216..1394422) Genome browser AA seq 68 aa AA seqDB search MSNPFDDENGSFYVLVNDEKQNSLWPAFADIPEGWTIAFGEDSRQACLDYVEENWTDMRP AHLVKEMG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagcaatccgttcgacgacgagaacggctcgttctatgtactcgtcaacgatgagaag cagaattcgctgtggcccgcgttcgccgacatccccgagggttggacgatcgccttcggc gaggacagccgtcaggcgtgcctggattacgtcgaggagaactggaccgacatgcggccc gcccacctggtgaaggagatgggctga

DBGET integrated database retrieval system