Streptomyces bingchenggensis: SBI_01363 Help Entry SBI_01363         CDS       T01678                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism sbh  Streptomyces bingchenggensis Pathway sbh00261   Monobactam biosynthesis sbh01100   Metabolic pathways sbh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SBI_01363  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sbh01008]     SBI_01363 Polyketide biosynthesis proteins [BR:sbh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SBI_01363 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADI04484 UniProt:  D7CBY9 LinkDB All DBs Position 1838984..1839217 Genome browser AA seq 77 aa AA seqDB search MSTNPFDDEGGQFFVLVNDEEQHSLWPAFAEVPAGWKTAFGPDSRQNCVGHVEQNWTDLR PKSLRESMAADVAVRRT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtgagcacgaatccatttgacgacgagggcggccaattcttcgttctggtgaacgacgag gaacagcattctctgtggcctgccttcgccgaagttccggcgggctggaaaaccgcgttc ggcccagacagccgtcagaactgcgtgggacatgtcgagcagaactggaccgatctgcgg ccgaagagcctgcgcgagtccatggccgccgacgtggcggtgcgccgcacatga

DBGET integrated database retrieval system