Shewanella baltica OS185: Shew185_1194 Help Entry Shew185_1194      CDS       T00571                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sbm  Shewanella baltica OS185 Pathway sbm00790   Folate biosynthesis sbm01100   Metabolic pathways sbm01240   Biosynthesis of cofactors Module sbm_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sbm00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Shew185_1194 Enzymes [BR:sbm01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Shew185_1194  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Shew185_1194  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Shew185_1194 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABS07345 LinkDB All DBs Position 1431866..1432216 Genome browser AA seq 116 aa AA seqDB search MDKVLIRQLRIDTVIGVYEWEKTIHQSLLLDLDMAWDNKPAAATDDYQYALCYETVSNRL TQLVTEHPIELIETVAERVADCLLQEFNVTWVKVVVMKPGAVATAASVGVEIERSR NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggataaggtacttatacggcaattgcgcattgatactgtgattggtgtctatgagtgg gaaaagacaattcatcagagcctgttattagacttagacatggcgtgggataacaaacct gccgctgcgacggatgattatcaatatgcgctgtgctatgagacagtttccaatcgatta acccaacttgttactgagcatccaatcgagttaatcgaaacggttgccgagcgagtggcc gattgcctacttcaagaatttaacgtgacttgggtgaaagttgtcgtgatgaagccaggc gcggtagcaactgcagcttcggttggcgtcgagattgaacgttcacgttag

DBGET integrated database retrieval system