Streptomyces buecherae: H7H31_22730 Help Entry H7H31_22730       CDS       T07050                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sby  Streptomyces buecherae Pathway sby00261   Monobactam biosynthesis sby01100   Metabolic pathways sby01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sby00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H7H31_22730  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sby01008]     H7H31_22730 Polyketide biosynthesis proteins [BR:sby01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H7H31_22730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNJ42249 UniProt:  A0A7G8KGR6 LinkDB All DBs Position complement(5763235..5763450) Genome browser AA seq 71 aa AA seqDB search MTNPFDDEDARYLVLVNAEGQHSLWPAITPVPAGWTVAHPEDSRAACVAYVEEHWSDLRP ASLRRLTEPAG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgacgacgaggacgcccgctacctcgtgctcgtcaacgccgagggc cagcactcgctgtggcccgccatcacccccgtaccggcgggctggacggtggcgcacccc gaggacagccgcgccgcgtgcgtggcctacgtcgaggagcactggagcgacctgcgcccg gccagcctgcgccggctgacggagccggccggctga

DBGET integrated database retrieval system