Staphylococcus carnosus subsp. carnosus: SCA_0166 Help Entry SCA_0166          CDS       T00863                                  Symbol folB Name (GenBank) 7,8-dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sca  Staphylococcus carnosus subsp. carnosus Pathway sca00790   Folate biosynthesis sca01100   Metabolic pathways sca01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:sca00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SCA_0166 (folB) Enzymes [BR:sca01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      SCA_0166 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      SCA_0166 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      SCA_0166 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  CAL27079 UniProt:  B9DLC4 LinkDB All DBs Position 169629..170003 Genome browser AA seq 124 aa AA seqDB search MTDTIFLNGMRFYGFHGVLEAENDIGQIFVVDVVLKVDLSAAGKSDSVDDTVNYAEVYAD VKEIMEGEPKNLLEHLATLIAKRINSHYNRVLETKVRITKETPPIPGHYDGVGIEISRVN SEHD NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgacagatacaatttttctcaatggaatgcgcttttatggttttcatggtgtgcttgaa gcagaaaatgacattgggcagatatttgttgtggatgtcgttttgaaagtagatttatct gcagcagggaaatcagattctgtagatgacactgtgaattatgcagaagtttatgcagat gtaaaagaaattatggaaggcgagcctaagaatttacttgaacatttggctacgcttatt gcaaaacgtataaattcacactataatcgggtattggaaactaaagtgagaattacaaaa gaaacaccacctattccaggacattacgatggggtaggaattgagatatcgagggtgaat tcagagcatgactaa

DBGET integrated database retrieval system