Streptomyces cadmiisoli: DN051_01455 Help Entry DN051_01455       CDS       T07301                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scad  Streptomyces cadmiisoli Pathway scad00261   Monobactam biosynthesis scad01100   Metabolic pathways scad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scad00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DN051_01455  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scad01008]     DN051_01455 Polyketide biosynthesis proteins [BR:scad01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DN051_01455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AWW35500 UniProt:  A0A2Z4IS08 LinkDB All DBs Position complement(357881..358093) Genome browser AA seq 70 aa AA seqDB search MTNPFEDQAATYLVLVNSEKQYSLWPTFVDLPGGWEIAFGEAPRQDCLEYVERTWTDMRP KSLVDAMGGN NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgacgaacccgttcgaggaccaggcagccacttacctggtgctggtcaactcggagaag cagtactcgctctggccgacctttgttgatctccccgggggctgggagatcgcgttcggc gaggctccgcgacaggactgcctggagtacgttgagcgcacatggaccgatatgcgaccc aagagcctggtcgatgccatgggcggcaattga

DBGET integrated database retrieval system