Streptomyces cadmiisoli: DN051_01465 Help Entry DN051_01465       CDS       T07301                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scad  Streptomyces cadmiisoli Pathway scad00261   Monobactam biosynthesis scad01100   Metabolic pathways scad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scad00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DN051_01465  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scad01008]     DN051_01465 Polyketide biosynthesis proteins [BR:scad01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DN051_01465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AWW35502 UniProt:  A0A2Z4IRA9 LinkDB All DBs Position 359655..359867 Genome browser AA seq 70 aa AA seqDB search MTNPFEDQDAQYLVLVNAEQQYSLWPAYIEVPQGWEIAHDEASRQDCLGYIEETWTDMRP KSLVDAMEGN NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgaggatcaggacgcccagtacctcgtgctggtcaacgcggagcag cagtactcgctgtggccggcctacatcgaggtcccccagggttgggagatcgcacatgac gaggcctcccggcaggactgcctgggctacatcgaagagacgtggaccgacatgcggccc aagagcctggtcgacgccatggaaggcaactga

DBGET integrated database retrieval system