Streptomyces caniscabiei: IHE65_43035 Help Entry IHE65_43035       CDS       T08931                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scae  Streptomyces caniscabiei Pathway scae00261   Monobactam biosynthesis scae01100   Metabolic pathways scae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scae00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IHE65_43035  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scae01008]     IHE65_43035 Polyketide biosynthesis proteins [BR:scae01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IHE65_43035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WEO29412 LinkDB All DBs Position complement(9784629..9784838) Genome browser AA seq 69 aa AA seqDB search MSNPFEDPEGTYLVLVNDENQYSLWPDFVDVPAGWRVVHGPDSRQACLEHVETHWTDMRP RSLAESMDG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaggaccccgagggcacctacctggtgctggtcaacgacgagaac cagtacagcctgtggccggacttcgtggatgtgccggccggctggcgggtggtgcacgga cccgactcccggcaggcctgcctggagcacgtcgagacccactggacggacatgcgcccg cgcagtctggccgagtcgatggacggctga

DBGET integrated database retrieval system