Streptomyces californicus: I6J39_01030 Help Entry I6J39_01030       CDS       T07611                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scal  Streptomyces californicus Pathway scal00261   Monobactam biosynthesis scal01100   Metabolic pathways scal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     I6J39_01030  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scal01008]     I6J39_01030 Polyketide biosynthesis proteins [BR:scal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     I6J39_01030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QRV26026 LinkDB All DBs Position 202970..203173 Genome browser AA seq 67 aa AA seqDB search MSDAPANPFDADGEFLVLTNAEGGHSLWPLFAAVPEGWSTAHGPCDRQDALDWISAHWAG PVAAPAR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgcacccgccaaccccttcgacgcggacggggagttcctcgtcctgaccaac gcggagggcgggcactcgctgtggccgctgttcgccgcggtgcccgagggctggtcgacg gctcacggtccgtgcgaccggcaggacgcgctggactggatctccgcgcactgggccggt cccgtcgccgcccccgcgcggtga

DBGET integrated database retrieval system