Streptomyces cavourensis: CVT27_00790 Help Entry CVT27_00790       CDS       T07023                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scav  Streptomyces cavourensis Pathway scav00261   Monobactam biosynthesis scav01100   Metabolic pathways scav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scav00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CVT27_00790  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scav01008]     CVT27_00790 Polyketide biosynthesis proteins [BR:scav01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CVT27_00790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH CABIT Motif Other DBs NCBI-ProteinID:  ATY94159 LinkDB All DBs Position 194788..194985 Genome browser AA seq 65 aa AA seqDB search MSDAPANPFDADGEFLVLTNDEGQHSLWPLFAAVPAGWSTAHGPCARQEALDWIGAHWSG PLAAR NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgagtgacgcacccgccaaccccttcgacgcggacggggagttcctcgtcctgaccaac gacgagggtcagcactcgctgtggccgctcttcgcggcggtgcccgccggctggtcgacg gcgcacggcccgtgcgcccgccaggaggcgctggactggatcggcgcccactggtccggc cccctcgccgcccggtga

DBGET integrated database retrieval system