Streptomyces cathayae: PYS65_07105 Help Entry PYS65_07105       CDS       T09946                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scay  Streptomyces cathayae Pathway scay00261   Monobactam biosynthesis scay01100   Metabolic pathways scay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scay00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PYS65_07105  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scay01008]     PYS65_07105 Polyketide biosynthesis proteins [BR:scay01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PYS65_07105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  WGD39922 LinkDB All DBs Position 1549137..1549349 Genome browser AA seq 70 aa AA seqDB search MATNPFEDDNASYHVLVNDENQHSLWPAFAEVPAGWTTVFGEATRQACLDYITENWTDMR PKSLAMAMDA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcgaccaacccgttcgaagacgacaacgcgagctaccacgtcctggtcaacgacgag aaccagcactcgctgtggcccgcgttcgccgaggtgccggccggctggaccacggtcttc ggcgaggcgacccgccaggcgtgcctcgactacatcaccgagaactggaccgacatgcgg cccaagagccttgcgatggccatggacgcctga

DBGET integrated database retrieval system