Streptomyces scabiei: SCAB_85461 Help Entry SCAB_85461        CDS       T01187                                  Name (GenBank) putative MbtH homolog   KO K05375   MbtH protein Organism scb  Streptomyces scabiei Pathway scb00261   Monobactam biosynthesis scb01100   Metabolic pathways scb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SCAB_85461  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scb01008]     SCAB_85461 Polyketide biosynthesis proteins [BR:scb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SCAB_85461 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CBG75491 UniProt:  C9Z1K8 LinkDB All DBs Position complement(9546026..9546235) Genome browser AA seq 69 aa AA seqDB search MSNPFEDPEGTYLVLVNDENQHSLWPDFVEVPAGWRVVHGPGSRQSCLDHVETHWTDMRP RSLAESMDG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaggaccccgagggcacctacctggtgctggtcaacgacgagaac cagcacagcctgtggccggacttcgtggaggtgcccgccggctggcgggtggtgcacggc cccggctcgcggcagtcctgcctggaccacgtcgagacccactggaccgacatgcggccg cgcagcctggccgagtcgatggacggctga

DBGET integrated database retrieval system