Streptomyces chartreusis: CP983_01480 Help Entry CP983_01480       CDS       T07157                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scha  Streptomyces chartreusis Pathway scha00261   Monobactam biosynthesis scha01100   Metabolic pathways scha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scha00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP983_01480  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scha01008]     CP983_01480 Polyketide biosynthesis proteins [BR:scha01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP983_01480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV65500 UniProt:  A0A8E3PEZ6 LinkDB All DBs Position complement(345978..346199) Genome browser AA seq 73 aa AA seqDB search MTNPFDNENGTFLVLVNDEGQHSLWPVFAEIPQGWTTAFGEASRAECLEFVEQNWTDMRP KSLVARMEDTATA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccctttcgacaacgagaacggcactttcctggtgctcgtcaacgacgagggc cagcactccctctggccggttttcgcggagatcccgcagggctggacgaccgccttcggt gaggcgagccgggccgaatgcctggaattcgtcgagcagaactggaccgacatgcggccc aagagcctcgtcgcccgcatggaggacaccgccacggcctga

DBGET integrated database retrieval system