Streptomyces chartreusis: CP983_41540 Help Entry CP983_41540       CDS       T07157                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scha  Streptomyces chartreusis Pathway scha00261   Monobactam biosynthesis scha01100   Metabolic pathways scha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scha00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP983_41540  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scha01008]     CP983_41540 Polyketide biosynthesis proteins [BR:scha01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP983_41540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV72496 UniProt:  A0A8E3QIQ5 LinkDB All DBs Position 9395258..9395458 Genome browser AA seq 66 aa AA seqDB search MSTNPFDDNEGRFLVLVNDEGQHSLWPSFAKVPGGWTTVFEENTREACLEYIESHWTDLR PRSLSA NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatcccttcgacgacaacgaaggccgcttcctggtcctggtgaacgacgag ggccagcactccctttggccgtccttcgccaaggtgcccggaggctggacgaccgtcttc gaggagaacacccgagaggcgtgcctggagtacatcgagtcccattggaccgacctgcgc ccccggtccctctcggcctag

DBGET integrated database retrieval system